PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00898.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 229aa    MW: 26690 Da    PI: 10.1658
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00898.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.5e-19449147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg W + Ede+l+d+v+q+G+++W++Ia +++ gR++k+c++rw++ 
  Rsa1.0_00898.1_g00001.1  4 RGHWRPSEDEKLKDLVEQYGPHNWNAIALKLP-GRSGKSCRLRWFNQ 49
                             899*****************************.***********996 PP

2Myb_DNA-binding60.34.2e-195699146
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                             r+++T+eE+e+l+ a++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Rsa1.0_00898.1_g00001.1 56 RNPFTEEEEERLLSAHRIHGNR-WSIIARLFP-GRTDNAVKNHWHV 99
                             789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.393150IPR017930Myb domain
SMARTSM007177.2E-16352IPR001005SANT/Myb domain
SuperFamilySSF466892.25E-30497IPR009057Homeodomain-like
PfamPF002491.3E-17449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-27557IPR009057Homeodomain-like
CDDcd001678.64E-15748No hitNo description
PROSITE profilePS5129426.06351105IPR017930Myb domain
SMARTSM007173.2E-1655103IPR001005SANT/Myb domain
PfamPF002494.7E-165698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-2258104IPR009057Homeodomain-like
CDDcd001671.43E-125898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MCSRGHWRPS EDEKLKDLVE QYGPHNWNAI ALKLPGRSGK SCRLRWFNQL DPRINRNPFT  60
EEEEERLLSA HRIHGNRWSI IARLFPGRTD NAVKNHWHVI MARRTRQTSK PRTLLPSMTS  120
SSSLMANEQI MMGSGDRKRI LGDVVNYPYQ FSHINHLQFL KEFFTGKVTL NTKANQSKKP  180
VEFYNFLQVD TDSNRSEVID QDSDKSNPND SDNKNENRVP FFDFLSVGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-3211051105C-Myb DNA-Binding Domain
1msf_C3e-3211051105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895001e-157AC189500.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB086N06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106005.11e-158PREDICTED: transcription factor WER
TrEMBLA0A078E3G11e-159A0A078E3G1_BRANA; BnaA07g30860D protein
STRINGBra015992.1-P1e-157(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28182769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73410.11e-123myb domain protein 54